TBX5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TBX5 |
TBX5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TBX5 |
Rabbit Polyclonal Anti-TBX5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the N terminal of human TBX5. Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT |
Rabbit Polyclonal Anti-TBX5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the middle region of human TBX5. Synthetic peptide located within the following region: RMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVS |
Rabbit Polyclonal Anti-TBX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the N terminal of human TBX5. Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT |
Rabbit Polyclonal Anti-Tbx5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tbx5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tbx5. Synthetic peptide located within the following region: TDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEG |
Rabbit Polyclonal Anti-TBX5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TBX5 |
TBX5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TBX5 (NP_852259.1). |
Modifications | Unmodified |