Antibodies

Jump to Filters
View as table Download
UXT Goat Polyclonal Antibody
TA303316

USD 375.00

In Stock

Goat Polyclonal Antibody against UXT

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DHRDKVYEQLAKY, from the C Terminus of the protein sequence according to NP_004173.1; NP_705582.1.
UXT Rabbit Polyclonal Antibody
TA383184

USD 275.00

3 Weeks

UXT Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 13-169 of human UXT (NP_705582.1).
Modifications Unmodified
UXT Rabbit Polyclonal Antibody
TA339896

USD 310.00

5 Days

Rabbit Polyclonal Anti-UXT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
UXT Rabbit Polyclonal Antibody
TA342539

USD 310.00

5 Days

Rabbit Polyclonal Anti-UXT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
UXT Rabbit Polyclonal Antibody
TA350593

USD 345.00

In Stock

Rabbit Polyclonal Anti-UXT Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein