Rabbit Polyclonal EGFR Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR (Ser1026) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1026 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1070 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser1071) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1071 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser695) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 695 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Thr678) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Threonine 678 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Thr693) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Threonine 693 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1016) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1016 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1092) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1092 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1110) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1110 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1172) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1172 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1197) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1197 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr869) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 869 |
Modifications | Phospho-specific |
Rabbit Polyclonal EGFR Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal MEK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1 |
Rabbit Polyclonal MEK1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 |
Rabbit Polyclonal MEK1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 |
Rabbit Polyclonal MEK1 (Thr291) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1 around the phosphorylation site of Threonine 291 |
Modifications | Phospho-specific |
Rabbit Polyclonal MEK1/2 (Ser217) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 217 |
Modifications | Phospho-specific |
Rabbit Polyclonal MEK1/2 (Ser221) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MEK1/2 around the phosphorylation site of Serine 221 |
Modifications | Phospho-specific |
Rabbit Polyclonal ERK1/2 (Tyr204) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Tyrosine 204 |
Modifications | Phospho-specific |
Rabbit Polyclonal p44/42 MAP Kinase (Thr202) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p44/42 MAP Kinase around the phosphorylation site of Threonine 202 |
Modifications | Phospho-specific |
Rabbit polyclonal p42 MAPK antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p42 MAPK. |
Rabbit polyclonal GRB2 (Phospho-Ser159) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GRB2 around the phosphorylation site of serine 159 (K-S-SP-A-P). |
Modifications | Phospho-specific |
Rabbit polyclonal MAPK1/3 (Phospho-Tyr205/222) antibody
Applications | WB |
Reactivities | Human: Tyr205/222, Mouse: Tyr203/223, Rat: Tyr203/223 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAPK1 around the phosphorylation site of tyrosine 204. |
Modifications | Phospho-specific |
Rabbit polyclonal MAPK1/3 (Ab-205/222) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MAPK1. |
Rabbit polyclonal p44 MAPK antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p44 MAPK. |
Rabbit Polyclonal Anti-ETV6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the C terminal of human ETV6. Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR |
Mouse Monoclonal Notch-1 Antibody (mN1A)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat (Negative) |
Conjugation | Unconjugated |
Rabbit Polyclonal Notch-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human NOTCH1 protein (between residues 2300-2350) [UniProt P46531] |
Rabbit Polyclonal Antibody against MAP2K1 (T291)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MAP2K1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 270-299 amino acids from human MAP2K1. |
Goat Polyclonal Antibody against GRB2
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PRNYVTPVNRNV, from the C Terminus of the protein sequence according to NP_002077.1; NP_987102.1. |
Rabbit Polyclonal CPEB1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CPEB1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human CPEB1. |
Rabbit anti-PIWIL1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide from the intermediate residues of human PIWIL1 protein. |
Rabbit anti-PIWIL2 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide from the intermediate residues of human PIWIL2 protein. |
Rabbit polyclonal EGFR (Ab-1026) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EGFR. |
Rabbit polyclonal EGFR (Ser1026) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of serine 1026 (F-S-SP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-NOTCH 1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD). |
Rabbit Polyclonal PIWI-L3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIWI-L3 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human PIWI-L3. |
Mouse monoclonal Erk1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-ERK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide mapping to the carboxy terminus of rat ERK2 |
Rabbit Polyclonal Anti-SOS1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sos1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sos1. Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3E6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5A11
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7E2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2B2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1F9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6C6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7B1
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |