Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ALDH1B1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1. |
Antibodies
View as table Download
Rabbit polyclonal anti-AKR1B1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AKR1B1. |
Rabbit polyclonal anti-DGKQ antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKQ. |
Rabbit polyclonal anti-GLPK2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLPK2. |
Rabbit polyclonal anti-DGKE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Rabbit polyclonal anti-DAK antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DAK. |
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit polyclonal AKR1A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human AKR1A1. |
Rabbit Polyclonal Anti-PNLIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal Anti-GLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
Rabbit Polyclonal Anti-DGKH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT |
Rabbit Polyclonal Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALDH1B1 |
PPAP2C (PLPP2) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Porcine |
| Immunogen | Synthetic peptide derived from the lipid phosphate phosphohydrolase 2 protein |
USD 360.00
5 Days
Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein |
DGKE rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against Monoglyceride Lipase
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLPHLVNADGQY, from the internal region (near N-Terminus) of the protein sequence according to NP_009214.1; NP_001003794.1. |
Rabbit Polyclonal Aldh3A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Rabbit polyclonal anti-DGKD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKD. |
Rabbit polyclonal anti-lipoprotein lipase (LPL) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 427 of rat PLP. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-PNLIP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNLIP antibody: synthetic peptide directed towards the C terminal of human PNLIP. Synthetic peptide located within the following region: GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal DGAT2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human DGAT2 protein (within residues 200-300). [Swiss-Prot Q96PD7] |
Rabbit Polyclonal Anti-DGKH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
Rabbit Polyclonal Anti-DGKD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL |
Rabbit Polyclonal Anti-DGKE Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
Rabbit Polyclonal Anti-DGKQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKQ antibody: synthetic peptide directed towards the middle region of human DGKQ. Synthetic peptide located within the following region: DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ |
Rabbit Polyclonal Anti-AGPAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT3 antibody: synthetic peptide directed towards the middle region of human AGPAT3. Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA |
Rabbit Polyclonal Anti-AGPAT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM |
AGPAT3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AGPAT3 |
1 AGP acyltransferase 4 (AGPAT4) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AGPAT4 |
GPAT4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 52~82 amino acids from the N-terminal region of human AGPAT6 |
Bile salt activated lipase (CEL) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 453-482 amino acids from the Central region of human CEL |
DGAT2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DGAT2. |
Pancreatic Lipase (PNLIP) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 311-341 amino acids from the C-terminal region of human Pancreatic lipase / PNLIP |
Goat Polyclonal Antibody against AGK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDPRKREQMLTSP, from the C Terminus of the protein sequence according to NP_060708.1. |
Goat Anti-Endothelial lipase Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFNLRTSKDPEHEG, from the internal region of the protein sequence according to NP_006024.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Glycerolipid metabolism
Filter by
Target Symbol
- LIPG (133)
- MGLL (68)
- LPL (61)
- AKR1A1 (52)
- DGKA (37)
- ALDH3A2 (36)
- PNLIP (15)
- ALDH2 (13)
- AKR1B1 (12)
- ALDH7A1 (11)
- PLPP1 (10)
- ALDH9A1 (7)
- DGKB (7)
- DGKZ (7)
- PNPLA3 (7)
- GK (6)
- LIPC (6)
- DGAT1 (5)
- GK2 (5)
- GPAT4 (5)
- AGPAT4 (4)
- ALDH1B1 (4)
- DGKD (4)
- GLYCTK (4)
- GPAM (4)
- AGK (3)
- AGPAT2 (3)
- AGPAT3 (3)
- CEL (3)
- DGAT2 (3)
- DGKE (3)
- DGKH (3)
- PLPP2 (3)
- TKFC (3)
- AWAT2 (2)
- DGKI (2)
- DGKQ (2)
- GLA (2)
- ALDEHYDE DEHYDROGENASE 10 (1)
- LCLAT1 (1)
- LIPF (1)
- PLPP3 (1)