Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-RPL26L antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human RPL26L. |
Rabbit polyclonal anti-RPL40 / UBA52 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL40. |
Rabbit polyclonal anti-RPL14 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL14. |
Rabbit polyclonal anti-RPL5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL5. |
Rabbit polyclonal anti-RPL12 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL12. |
Rabbit polyclonal anti-RPL15 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL15. |
Rabbit polyclonal anti-RPL18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL18. |
Rabbit polyclonal anti-RPL28 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL28. |
Rabbit polyclonal anti-RPLP2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPLP2. |
Rabbit polyclonal S6 Ribosomal Protein (Ser235+Ser236) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human S6 Ribosomal Protein around the phosphorylation site of serine 235and 236 (R-L-SP-SP-L-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-RPS11 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS11. |
Rabbit polyclonal anti-RPS18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPS18. |
Rabbit polyclonal anti-RPL10L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL10L. |
Rabbit Polyclonal S6 Ribosomal Protein Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human S6 Ribosomal Protein |
Rabbit Polyclonal S6 Ribosomal Protein (Ser235) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human S6 Ribosomal Protein around the phosphorylation site of Serine 235 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RPS16 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the N terminal of human RPS16. Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL |
Rabbit Polyclonal Anti-RPS28 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPS28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPS28. Synthetic peptide located within the following region: RTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLTLLESEREARRLR |
Rabbit Polyclonal Antibody against FAU (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-59 amino acids from the C-terminal region of human FAU. |
Goat Polyclonal Antibody against RPS19
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KMVEKDQDGGRK, from the internal region of the protein sequence according to NP_001013.1. |
Goat Polyclonal Antibody against RPS27
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PLAKDLLHPSPEE-C, from the N Terminus of the protein sequence according to NP_001021.1. |
Rabbit anti-RPS2 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human RPS2. |
Rabbit polyclonal anti-RPL22 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL22. |
Rabbit polyclonal anti-RPL39 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL39. |
Rabbit polyclonal anti-RPS15 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS15. |
Anti-RPS6 (Phospho-Ser235) Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 235 (R-L-S(p)-S-L) derived from Human S6 Ribosomal Protein. |
| Modifications | Phospho-specific |
Rabbit polyclonal RPL29 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RPL29 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the Central region of human RPL29. |
Rabbit Polyclonal Anti-RPS18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK |
Rabbit Polyclonal Anti-RPS16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the middle region of human RPS16. Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC |
Rabbit Polyclonal Anti-RPL18A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL18A antibody is: synthetic peptide directed towards the C-terminal region of Human RPL18A. Synthetic peptide located within the following region: IMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTF |
Rabbit polyclonal Anti-RPL18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR |
Rabbit Polyclonal Anti-RPL30 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPL30 Antibody: synthetic peptide directed towards the middle region of human RPL30. Synthetic peptide located within the following region: MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE |
Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK |
Rabbit Polyclonal Anti-RPS27A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPS27A antibody: synthetic peptide directed towards the middle region of human RPS27A. Synthetic peptide located within the following region: LRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECP |
Goat Polyclonal Antibody against RPL8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KAGRAYHKYKAKRNC, from the internal region of the protein sequence according to NP_000964.1; NP_150644.1. |
Goat Polyclonal Antibody against RPL17
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RYSLDPENPTKSC, from the N Terminus of the protein sequence according to NP_000976.1; NP_001030178.1. |
Rabbit polyclonal antibody to RPL14 (ribosomal protein L14)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 135 of RPL14 (Uniprot ID#P50914) |
Rabbit Polyclonal Ubiquitin Antibody
| Applications | IF |
| Reactivities | Bovine, C. elegans, Chicken, Drosophila, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Gluteraldehyde cross-linked ubiquitin. |
Rabbit anti-RPL13 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human RPL13. |
Rabbit anti-RPL37 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human RPL37. |
Goat Anti-Ribosomal Protein L19 / RPL19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LRRYRESKKIDRH, from the internal region of the protein sequence according to NP_000972.1. |
Rabbit polyclonal anti-RPL19 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPL19. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-RPS2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human RPS2. |
Active filters
Reactivities
- Human
Pathways
- Ribosome
Filter by
Category
Target Symbol
- UBA52 (72)
- RPL7A (16)
- RPL10 (13)
- RPL10A (12)
- RPS6 (10)
- MRPL13 (7)
- RPL27 (6)
- RPSA (6)
- RPLP0 (5)
- RPS3 (5)
- RPL15 (4)
- RPS2 (4)
- RPS21 (4)
- RPS27A (4)
- RPS9 (4)
- FAU (3)
- RPL11 (3)
- RPL13 (3)
- RPL13A (3)
- RPL14 (3)
- RPL19 (3)
- RPL28 (3)
- RPL3 (3)
- RPL30 (3)
- RPL37 (3)
- RPL5 (3)
- RPL8 (3)
- RPLP2 (3)
- RPS11 (3)
- RPS13 (3)
- RPS19 (3)
- RPS27 (3)
- RPS4Y1 (3)
- RPS7 (3)
- RPL12 (2)
- RPL17 (2)
- RPL18 (2)
- RPL22 (2)
- RPL23A (2)
- RPL26L1 (2)
- RPL27A (2)
- RPL34 (2)
- RPL36 (2)
- RPL36AL (2)
- RPL39 (2)
- RPL4 (2)
- RPL7 (2)
- RPL9 (2)
- RPS10 (2)
- RPS15 (2)
- RPS16 (2)
- RPS17 (2)
- RPS18 (2)
- RPS27L (2)
- RPS3A (2)
- RPS5 (2)
- RSL24D1 (2)
- RPL10L (1)
- RPL18A (1)
- RPL21 (1)
- RPL23 (1)
- RPL26 (1)
- RPL29 (1)
- RPL31 (1)
- RPL32 (1)
- RPL35 (1)
- RPL36A (1)
- RPL37A (1)
- RPL3L (1)
- RPL6 (1)
- RPLP1 (1)
- RPS12 (1)
- RPS15A (1)
- RPS20 (1)
- RPS23 (1)
- RPS24 (1)
- RPS25 (1)
- RPS28 (1)
- RPS29 (1)
- RPS4X (1)
- RPS8 (1)