FARSLB (FARSB) mouse monoclonal antibody, clone 2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
FARSLB (FARSB) mouse monoclonal antibody, clone 2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-FARSB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR |
Rabbit Polyclonal Anti-FARSB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: HDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYL |
Carrier-free (BSA/glycerol-free) FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FARSB Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FARSB |
FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |