Rabbit Polyclonal Anti-AARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AARS antibody: synthetic peptide directed towards the C terminal of human AARS. Synthetic peptide located within the following region: VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT |
Rabbit Polyclonal Anti-SLA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLA antibody: synthetic peptide directed towards the N terminal of human SLA/LP. Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the C terminal of human CARS. Synthetic peptide located within the following region: KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY |
Rabbit Polyclonal Anti-KARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV |
Rabbit polyclonal RARS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RARS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 605-634 amino acids from the C-terminal region of human RARS. |
Rabbit anti-WARS Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WARS |
Rabbit Polyclonal Anti-GARS Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GARS antibody: synthetic peptide directed towards the middle region of human GARS. Synthetic peptide located within the following region: IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN |
Rabbit Polyclonal Anti-WARS Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WARS antibody: synthetic peptide directed towards the N terminal of human WARS. Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CARS antibody is: synthetic peptide directed towards the N-terminal region of Human CARS. Synthetic peptide located within the following region: ADSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAF |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the middle region of human CARS. Synthetic peptide located within the following region: QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY |
Rabbit Polyclonal Anti-AARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AARS antibody: synthetic peptide directed towards the N terminal of human AARS. Synthetic peptide located within the following region: DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP |
Rabbit Polyclonal Anti-YARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YARS antibody: synthetic peptide directed towards the C terminal of human YARS. Synthetic peptide located within the following region: QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE |
Rabbit Polyclonal Anti-YARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YARS antibody: synthetic peptide directed towards the N terminal of human YARS. Synthetic peptide located within the following region: MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV |
Rabbit Polyclonal Anti-SARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SARS antibody: synthetic peptide directed towards the middle region of human SARS. Synthetic peptide located within the following region: SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL |
Rabbit Polyclonal EPRS Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
GARS mouse monoclonal antibody, clone AT4E10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
GARS mouse monoclonal antibody, clone AT4E10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-FARSA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FARSA antibody is: synthetic peptide directed towards the C-terminal region of Human FARSA. Synthetic peptide located within the following region: TFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLR |
Rabbit Polyclonal Anti-CARS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CARS2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARS2. Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW |
Rabbit Polyclonal Anti-FARSB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR |
USD 479.00
5 Days
Mouse Monoclonal Sars Spike Protein Antibody (16F1071)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 515.00
5 Days
Rabbit Polyclonal Anti-TARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARS antibody: synthetic peptide directed towards the N terminal of human TARS. Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT |
Rabbit polyclonal Anti-QARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QARS antibody: synthetic peptide directed towards the N terminal of human QARS. Synthetic peptide located within the following region: DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV |
TARSL2 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human TARSL2 |
Goat Anti-RARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLQAERNKPTKN, from the internal region of the protein sequence according to NP_002878.2. |
Goat Anti-AARS2 (aa478-489) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHRARQAEPVQK, from the internal region of the protein sequence according to NP_065796.1. |
Rabbit polyclonal anti-MTFMT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTFMT antibody: synthetic peptide directed towards the C terminal of human MTFMT. Synthetic peptide located within the following region: SVMLKKSLTATDFYNGYLHPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTV |
Rabbit Polyclonal Anti-DARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DARS antibody is: synthetic peptide directed towards the C-terminal region of Human DARS. Synthetic peptide located within the following region: LAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHH |
Rabbit Polyclonal Anti-MARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARS antibody: synthetic peptide directed towards the middle region of human MARS. Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ |
Rabbit Polyclonal Anti-TARSL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TARSL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TARSL2. Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV |
Rabbit Polyclonal Anti-FARSB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: HDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYL |
Rabbit Polyclonal Anti-YARS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH |
Rabbit Polyclonal Anti-PARS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARS2. Synthetic peptide located within the following region: AIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEA |
Rabbit Polyclonal Anti-PARS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the N-terminal region of Human PARS2. Synthetic peptide located within the following region: GGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAI |
Rabbit Polyclonal Anti-IARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG |
Rabbit Polyclonal Anti-IARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IARS antibody: synthetic peptide directed towards the middle region of human IARS. Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD |
Germany
Japan
United Kingdom
China
