PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
PARP2 (389-401) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human PARP2 |
Goat Polyclonal Antibody against PARP2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LDLFEVEKDGEKE, from the internal region of the protein sequence according to NP_005475.1. |
Rabbit Polyclonal Anti-PARP2 Antibody
Applications | IF, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
Rabbit polyclonal anti-PARP2 antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PARP2. |
Rabbit Polyclonal Anti-PARP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARP2. Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD |