Rabbit Polyclonal Anti-CD253 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Rabbit Polyclonal Anti-CD253 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Rabbit Polyclonal Trail Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail. |
Rabbit polyclonal anti-CD253 / TNFSF10 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD253. |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, Azide Free
Applications | FC, FN |
Reactivities | Human |
Mouse Monoclonal TRAIL/TNFSF10 Antibody (55B709.3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse. |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, Purified
Applications | FC |
Reactivities | Human |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-S23, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
TRAIL (TNFSF10) mouse monoclonal antibody, clone B-T24, Azide Free
Applications | FN |
Reactivities | Human |
Mouse Anti-Human CD253 (TRAIL) Purified (25 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-Human sTRAIL/Apo2L Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTRAIL/Apo2L |
Rabbit Polyclonal Anti-TNFSF10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE |
Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin. |
Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse. |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI12E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI2C12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI6B5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFSF10 mouse monoclonal antibody,clone OTI9A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNFSF10 mouse monoclonal antibody,clone OTI12E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI12E12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI12E12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI12E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TNFSF10 mouse monoclonal antibody,clone OTI2C12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI2C12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI2C12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI2C12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TNFSF10 mouse monoclonal antibody,clone OTI6B5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI6B5, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI6B5, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI6B5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TNFSF10 mouse monoclonal antibody,clone OTI9A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI9A8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF10 mouse monoclonal antibody,clone OTI9A8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TNFSF10 mouse monoclonal antibody,clone OTI9A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".