Mouse IL-33 Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse IL-33 Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal IL-33 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IL-33 antibody was raised against a 19 amino acid peptide from near the center of human IL-33. |
Mouse IL-33 Monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal IL-33 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-33 antibody was raised against a 19 amino acid peptide from near the amino terminus of human IL-33. |
Rabbit Polyclonal Anti-IL33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC |
IL33 mouse monoclonal antibody, clone B-L33, Azide Free
Reactivities | Human |
IL33 mouse monoclonal antibody, clone B-S33, Azide Free
Reactivities | Human |
Rabbit polyclonal IL-33 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein. |
Rabbit polyclonal anti-IL-33 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein. |
Rabbit polyclonal IL-33 antibody Biotin Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein. |
Anti-Human IL-33 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-33 |
Mouse Monoclonal IL-33 Antibody (6H496)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |