Antibodies

View as table Download

Rabbit Polyclonal ECSIT Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ECSIT antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human ECSIT.

Rabbit polyclonal ECSIT Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ECSIT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-425 amino acids from the C-terminal region of human ECSIT.

Rabbit Polyclonal Anti-Ecsit Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SITPEC antibody: synthetic peptide directed towards the middle region of mouse SITPEC. Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP