Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-TPI1 Antibody
| Applications | WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Drosophila, Yeast |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
USD 1,140.00
9 Weeks
USD 424.00
5 Days
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
Rabbit anti TK1 (Thymidine Kinase) Polyclonal Antibody
| Applications | WB |
| Reactivities | Drosph |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of fruit fly thymidine kinase protein. |
Germany
Japan
United Kingdom
China
