Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DGKA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKA. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DGKA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKA antibody: synthetic peptide directed towards the N terminal of human DGKA. Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL |
Carrier-free (BSA/glycerol-free) DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DGKA mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | FC, WB |
| Reactivities | Human, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
DGKA mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
DGKA mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
| Applications | IF, WB |
| Reactivities | Human, Monkey, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- DGKA
Pathways
- Metabolic pathways