PYCR2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 96-124 amino acids from the Central region of Human PYCR2 |
PYCR2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 96-124 amino acids from the Central region of Human PYCR2 |
Rabbit Polyclonal Anti-PYCR2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE |
Rabbit Polyclonal Anti-PYCR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the C terminal of human PYCR2. Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI5B7 (formerly 5B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PYCR2 mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".