Antibodies

View as table Download

Rabbit Polyclonal Anti-PSTPIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSTPIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human PSTPIP1. Synthetic peptide located within the following region: LLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSH

PSTPIP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 88-118 amino acids from the N-terminal region of Human PSTPIP1 / CD28P1

PSTPIP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated