Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PDE3B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PDE3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN |
Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PDE3B mouse monoclonal antibody,clone OTI3F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE3B mouse monoclonal antibody,clone OTI3F5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PDE3B mouse monoclonal antibody,clone OTI3F5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PDE3B mouse monoclonal antibody,clone OTI3F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- PDE3B
Pathways
- Progesterone-mediated oocyte maturation