Antibodies

Jump to Filters
View as table Download
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA344294

USD 475.00

5 Days

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA336859

USD 410.00

5 Days

Rabbit Polyclonal Alpha Fodrin Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant construct containing the 7th, 8th and 9th spectrin repeats of human Alpha Fodrin (amino acids 676-1043). [UniProt# Q13813]
Alpha Fodrin (SPTAN1) (676-1043) Mouse Monoclonal Antibody
MO22110-100

USD 380.00

2 Weeks

Alpha Fodrin (SPTAN1) (676-1043) mouse monoclonal antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
CF812019

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA351749

USD 345.00

In Stock

Rabbit Polyclonal Anti-SPTAN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPTAN1
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
TA812019

USD 379.00

In Stock

SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C10]
TA812019AM

USD 420.00

4 Weeks

SPTAN1 mouse monoclonal antibody,clone OTI9C10, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C10]
TA812019BM

USD 420.00

4 Weeks

SPTAN1 mouse monoclonal antibody,clone OTI9C10, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
TA812019S

USD 159.00

2 Days

SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated