Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ERp72 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ERp72 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ERp72. |
ERp72 (PDIA4) (623-638) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | PDIA4 antibody was raised against a synthetic peptide based on the sequence of mouse ERp72 (residues 623-638) with a cysteine residue added and coupled to KLH. |
Rabbit Polyclonal Anti-PDIA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the N terminal of human PDIA4. Synthetic peptide located within the following region: ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL |
Rabbit Polyclonal Anti-PDIA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the middle region of human PDIA4. Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA |
Carrier-free (BSA/glycerol-free) PDIA4 mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI6B6 (formerly 6B6)
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDIA4 (ERp72) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- PDIA4
Pathways
- Vibrio cholerae infection