SCN5A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN5A |
SCN5A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN5A |
Rabbit Polyclonal Anti-Human NaV1.5
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with amino acid residues 1978-2016 of human Nav1.5. Intracellular, C-terminus. |
Rabbit polyclonal Anti-NaV1.5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide DRLPKSDSEDGPRALNQLS(C), corresponding to amino acid residues 493-511 of? rat NaV1.5. Intracellular loop between domains I and II. |
Rabbit polyclonal Sodium Channel-pan antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human sodium channel. |
Rabbit Polyclonal Anti-SCN5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED |
Rabbit Polyclonal Anti-SCN5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
Rabbit Polyclonal Anti-SCN5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH |
Mouse monoclonal Anti-Nav 1.5 Clone 4G8:1G7
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI5E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCN5A mouse monoclonal antibody,clone OTI4B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SCN5A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit |
Anti-SCN5A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit |
SCN5A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN5A |
SCN5A mouse monoclonal antibody,clone OTI5E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI5E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI4B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SCN5A mouse monoclonal antibody,clone OTI4B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |