Antibodies

View as table Download

PAX7 (411-521) mouse monoclonal antibody, clone 1E12, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse

PAX7 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 417-445 amino acids from the C-terminal region of human PAX7

Rabbit Polyclonal anti-Pax7 antibody

Applications IF, WB
Reactivities Mouse, Rat
Immunogen The immunogen for anti-Pax7 antibody: synthetic peptide directed towards the middle region of human Pax7. Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ

Rabbit Polyclonal Anti-PAX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK

PAX7 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 180-210 amino acids from the Central region of human PAX

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the middle region of human PAX7. Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: CDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGIL

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7. Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PAX7 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 245 amino acids of human paired box 7

PAX7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 289-518 of human PAX7 (NP_039236.1).
Modifications Unmodified

PAX7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 289-518 of human PAX7 (NP_039236.1).
Modifications Unmodified

PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4A7, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PAX7 mouse monoclonal antibody,clone OTI4A7, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4G5, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PAX7 mouse monoclonal antibody,clone OTI4G5, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP