Antibodies

Jump to Filters
View as table Download
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA371750

USD 380.00

4 Weeks

PRDX4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA371747

USD 380.00

4 Weeks

PRDX4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA327054

USD 374.00

3 Weeks

Rabbit anti-PRDX4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA321764

USD 345.00

4 Weeks

Anti-PRDX4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 38-271 amino acids of human peroxiredoxin 4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA338130

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRDX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDX4. Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA338131

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRDX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the C-terminal region of Human PRDX4. Synthetic peptide located within the following region: GLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWK
Peroxiredoxin 4 (PRDX4) Mouse Monoclonal Antibody [Clone ID: OTI9A3]
CF500684

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PRDX4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PRDX4 Rabbit Polyclonal Antibody
TA367521

USD 380.00

4 Weeks

PRDX4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4
PRDX4 Rabbit Polyclonal Antibody
TA367524

USD 380.00

4 Weeks

PRDX4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4
Peroxiredoxin 4 (PRDX4) Rabbit Polyclonal Antibody
TA380308

USD 220.00

3 Weeks

Peroxiredoxin 4 (PRDX4) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)).
Peroxiredoxin 4 (PRDX4) Mouse Monoclonal Antibody [Clone ID: OTI9A3]
TA500684

USD 379.00

In Stock

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Peroxiredoxin 4 (PRDX4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A3]
TA500684AM

USD 420.00

4 Weeks

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Peroxiredoxin 4 (PRDX4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9A3]
TA500684BM

USD 420.00

4 Weeks

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Peroxiredoxin 4 (PRDX4) Mouse Monoclonal Antibody [Clone ID: OTI9A3]
TA500684S

USD 159.00

2 Days

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated