Rabbit polyclonal Keratin 19 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 19. |
Rabbit polyclonal Keratin 19 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 19. |
Mouse Monoclonal Cytokeratin 19 Antibody (4E8)
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
purified KRT19 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5D1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
Rabbit Polyclonal Anti-KRT19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR |
Rabbit Polyclonal Anti-Keratin 19 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19 |
Rabbit Polyclonal Cytokeratin 19 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the C-terminal region of human Cytokeratin 19 (between residues 350-400) [UniProt P08727] |
Rabbit Polyclonal Cytokeratin 19 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human Cytokeratin 19 protein (between residues 1-50) [UniProt P08727] |
Rabbit anti Cytokeratin-19 (CK-19) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human Cytokeratin protein. |
Goat Anti-cytokeratin 19 (aa285-298) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HTEQLQMSRSEVTD, from the internal region of the protein sequence according to NP_002267.2. |
Goat Anti-cytokeratin 19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EGQEDHYNNLSASK, from the C Terminus of the protein sequence according to NP_002267.2. |
Mouse monoclonal Anti-Keratin19 Clone BA16
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Keratin19 Clone BA17
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Keratin 19 Clone LAS86
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
2 Weeks
purified KRT19 Capture mouse monoclonal antibody, Luminex validated, clone OTI4E12
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI4E12 (formerly 4E12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CK19 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI5B11 (formerly 5B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI6A8 (formerly 6A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI7H7 (formerly 7H7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI6E8 (formerly 6E8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI8H7 (formerly 8H7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI9A9 (formerly 9A9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19 mouse monoclonal antibody, clone OTI5H6 (formerly 5H6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) KRT19 mouse monoclonal antibody, clone OTI8D1 (formerly 8D1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Cytokeratin 19 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Cytokeratin 19 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | HRP |
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | HRP |
CK19 (Keratin 19) mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI4E12 (formerly 4E12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |