Antibodies

View as table Download

PFKFB4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFKFB4

Rabbit polyclonal Anti-PFKFB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKFB4 antibody: synthetic peptide directed towards the N terminal of human PFKFB4. Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Carrier-free (BSA/glycerol-free) PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PFKFB4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFKFB4

Anti-PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated