Goat Anti-RORC (aa200-212) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CHLEYSPERGKAE, from the internal region of the protein sequence according to NP_005051.2; NP_001001523.1. |
Goat Anti-RORC (aa200-212) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CHLEYSPERGKAE, from the internal region of the protein sequence according to NP_005051.2; NP_001001523.1. |
Mouse Monoclonal ROR gamma/RORC/NR1F3 Antibody (4G419)
Applications | FC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit polyclonal anti-RORG antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RORG. |
Mouse Monoclonal anti-ROR? Antibody
Applications | WB |
Reactivities | Human, Weakly Cross-Reactive with Mouse |
Conjugation | Unconjugated |
Hamster Polyclonal anti-ROR gamma Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Rorc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG |
Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI1G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RORC Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human RORC (NP_005051.2). |
Modifications | Unmodified |
RORC mouse monoclonal antibody,clone OTI3C12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C12, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C12, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RORC mouse monoclonal antibody,clone OTI3C12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RORC mouse monoclonal antibody,clone OTI3C9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI3C9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RORC mouse monoclonal antibody,clone OTI3C9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RORC mouse monoclonal antibody,clone OTI1G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI1G3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RORC mouse monoclonal antibody,clone OTI1G3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RORC mouse monoclonal antibody,clone OTI1G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |