Antibodies

Jump to Filters
View as table Download
GALM Rabbit Polyclonal Antibody
AP21347BT-N

USD 410.00

2 Weeks

GALM rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Mutarotase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure.
GALM Rabbit Polyclonal Antibody
AP21347AF-N

USD 240.00

2 Weeks

GALM rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Mutarotase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure.
GALM Rabbit Polyclonal Antibody
R1100

USD 1,380.00

3 Days

GALM rabbit polyclonal antibody, Serum

Applications ELISA, IP, WB
Reactivities Porcine
Immunogen Mutarotase [Porcine Kidney].
GALM Rabbit Polyclonal Antibody
R1100BS

USD 540.00

3 Days

GALM rabbit polyclonal antibody, Biotin, Purified

Applications ELISA, IP, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Mutarotase from porcine kidney
GALM Rabbit Polyclonal Antibody
R1100HRPS

USD 540.00

3 Days

GALM rabbit polyclonal antibody, HRP, Purified

Applications ELISA, IP, WB
Reactivities Porcine
Conjugation HRP
Immunogen Mutarotase from porcine kidney
GALM Rabbit Polyclonal Antibody
R1100PS

USD 530.00

3 Days

GALM rabbit polyclonal antibody, Purified

Applications ELISA, IP, WB
Reactivities Porcine
Immunogen Mutarotase from porcine kidney
Mutarotase (GALM) Rabbit Polyclonal Antibody
TA340314

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the N terminal of human GALM. Synthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
Mutarotase (GALM) Rabbit Polyclonal Antibody
TA340315

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI7B7]
CF812291

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI7B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI4F4]
CF812300

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI4F4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI10B3]
CF812311

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI10B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI2F8]
CF812316

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI2F8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALM Rabbit Polyclonal Antibody
TA366499

USD 380.00

4 Weeks

GALM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALM
GALM Rabbit Polyclonal Antibody
TA370848

USD 380.00

4 Weeks

GALM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALM
Mutarotase (GALM) Rabbit Polyclonal Antibody
TA376465

USD 220.00

3 Weeks

GALM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human GALM (NP_620156.1).
Modifications Unmodified