Antibodies

View as table Download

PRDX4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4

PRDX4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4

Rabbit anti-PRDX4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX4

Peroxiredoxin 4 (PRDX4) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 89-118 amino acids from the Central region of human PRDX4

Anti-PRDX4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 38-271 amino acids of human peroxiredoxin 4

Rabbit Polyclonal Anti-PRDX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDX4. Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL

Rabbit Polyclonal Anti-PRDX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX4 antibody is: synthetic peptide directed towards the C-terminal region of Human PRDX4. Synthetic peptide located within the following region: GLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWK

Carrier-free (BSA/glycerol-free) PRDX4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PRDX4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4

PRDX4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRDX4

Peroxiredoxin 4 (PRDX4) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)).

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PRDX4 (Peroxiredoxin 4) mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated