ACP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACP5 |
ACP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACP5 |
Rabbit anti-ACP5 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACP5 |
Rabbit polyclonal antibody to TRAP (acid phosphatase 5, tartrate resistant)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 28 and 325 of TRAP (Uniprot ID#P13686) |
Rabbit Polyclonal Anti-ACP5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ |
Rabbit Polyclonal TRAP Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRAP antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human TRAP. |
USD 265.00
5 Days
Mouse Monoclonal anti-tartrate-resistant acid phosphatase (TRAcP) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 1,520.00
3 Weeks
Tartrate-Resistant Acid Phosphatase (TRAP) Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
ACP5 Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ACP5 |
ACP5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACP5 |
ACP5 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 76-325 of human ACP5 (NP_001602.1). |
Modifications | Unmodified |
USD 380.00
4 Weeks
TR AP (8A10) Mouse monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |