Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal ATF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ATF1 |
Rabbit Polyclonal ATF1 (Ser63) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ATF1 around the phosphorylation site of Serine 63 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-ATF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF1. Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ |
Rabbit Polyclonal anti-ATF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the middle region of human ATF1. Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR |
Rabbit Polyclonal Anti-ATF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the N terminal of human ATF1. Synthetic peptide located within the following region: ETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR |
Rabbit Polyclonal Anti-ATF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the C terminal of human ATF1. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV |
Mouse monoclonal Anti-ATF1 Clone ATF1 2A9/8
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- ATF1