Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-BMI1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMI1 |
Rabbit Polyclonal Anti-BMI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-PCGF4 Antibody: synthetic peptide directed towards the C terminal of human PCGF4. Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
Rabbit Polyclonal Anti-BMI1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BMI1 |
Bmi1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
BMI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BMI1 |
Bmi1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-326 of human Bmi1 (NP_005171.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- BMI1