Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Properdin (CFP) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | The antigen has been isolated from pooled Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Properdin (CFP) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | The antigen has been isolated from pooled Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Properdin (CFP) mouse monoclonal antibody, clone 10-18, Purified
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
Properdin (CFP) mouse monoclonal antibody, clone 10-24, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit Polyclonal Anti-CFP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CFP antibody: synthetic peptide directed towards the N terminal of human CFP. Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS |
Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Properdin (CFP) mouse monoclonal antibody, clone KT20, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit Polyclonal Anti-CFP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CFP antibody: synthetic peptide directed towards the middle region of human CFP. Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE |
CFP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse CFP |
CFP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-469 of human CFP (NP_001138724.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CFP