Antibodies

View as table Download

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1

Rabbit Polyclonal Anti-CaVBeta1

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DRATGEHASVHEYPGE, corresponding to amino acid residues 456-471 of rat CaVÃ?1. Intracellular, adjacent to the C-terminus.

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP

CACNB1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 542-572 amino acids from the C-terminal region of human CACNB1

Mouse Monoclonal Anti-CaVbeta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the C terminal of human CACNB1. Synthetic peptide located within the following region: RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE

Carrier-free (BSA/glycerol-free) CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

CACNB1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CACNB1

CACNB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1

CACNB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 429-598 of human CACNB1 (NP_000714.3).
Modifications Unmodified

CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated