Rabbit anti-CAPN1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-CAPN1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CAPN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE |
Rabbit polyclonal anti-Calpain 1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 700 of rat Calpain 1 |
Rabbit Polyclonal Anti-CAPN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the N terminal of human CAPN1. Synthetic peptide located within the following region: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL |
Anti-CAPN1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Anti-CAPN1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
CAPN1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAPN1 |
Calpain 1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-330 of human Calpain 1 (NP_005177.2). |
| Modifications | Unmodified |