Rabbit polyclonal CBX3 / HP1 gamma (Ser93) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HP1? around the phosphorylation site of serine 93 (R-K-SP-L-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CBX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX3 antibody: synthetic peptide directed towards the middle region of human CBX3. Synthetic peptide located within the following region: ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG |
Goat Polyclonal Antibody against CBX3 / HP1 Gamma
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EAFLNSQKAGKEKD, from the internal region of the protein sequence according to NP_009207.2; NP_057671.2. |
Rabbit polyclonal CBX3 / HP1 gamma (Ab-93) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HP1? around the phosphorylation site of serine 93 (R-K-SP-L-S). |
Rabbit Polyclonal Anti-CBX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX3 antibody: synthetic peptide directed towards the middle region of human CBX3. Synthetic peptide located within the following region: WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDA |
Rabbit Polyclonal Anti-CBX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CBX3 |
HP1 gamma/CBX3 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2). |
| Modifications | Unmodified |
Phospho-HP1 gamma/CBX3-S83 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S83 of human HP1 gamma/CBX3 |
| Modifications | Phospho S83 |
HP1 gamma Rabbit polyclonal Antibody
| Applications | FC, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human HP1 gamma |
Germany
Japan
United Kingdom
China
