Antibodies

Jump to Filters
View as table Download
TCP1 beta (CCT2) Rat Monoclonal Antibody [Clone ID: PK/8/4/4i/2f]
AM20387PU-N

USD 490.00

2 Weeks

TCP1 beta (CCT2) rat monoclonal antibody, clone PK/8/4/4i/2f, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Canine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep
TCP1 beta (CCT2) (227-473) Rabbit Polyclonal Antibody
AP23626PU-N

USD 440.00

2 Weeks

TCP1 beta (CCT2) (227-473) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 277 and 473 of Human TCP1 beta
TCP1 beta (CCT2) Rabbit Polyclonal Antibody
TA308346

USD 415.00

5 Days

Rabbit Polyclonal antibody to TCP1 beta (chaperonin containing TCP1, subunit 2 (beta))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 277 and 503 of TCP1 beta (Uniprot ID#P78371)
TCP1 beta (CCT2) Rabbit Polyclonal Antibody
TA343307

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCT2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCT2 antibody is: synthetic peptide directed towards the middle region of CCT2. Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA
TCP1 beta (CCT2) Rabbit Polyclonal Antibody
TA358418

USD 360.00

5 Days

CCT2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
TCP1 beta (CCT2) Rabbit Polyclonal Antibody
TA374403

USD 220.00

3 Weeks

TCP1 beta/CCT2 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 206-535 of human TCP1 beta/TCP1 beta/CCT2 (NP_006422.1).
Modifications Unmodified