Germany
Japan
United Kingdom
China
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Clcn1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV |
Rabbit Polyclonal Anti-CLC-1
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CVHRLGRVLRRKLGED, corresponding to amino acid residues 102-117 of rat CLC-1. Cytoplasmic, N-terminal part. |
CLCN1 Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse CLCN1 |
Active filters
Target Symbol
- CLCN1