Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit anti-CLCN5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN5 |
Rabbit Polyclonal Anti-CLC-5
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CDYENHFNTSKGGEL, corresponding to amino acid residues 401-415 of rat CLC5. Extracellular. |
Rabbit Polyclonal Anti-Clcn5 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Clcn5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL |
CLCN5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN5 |
CLCN5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CLCN5 |
Germany
Japan
United Kingdom
China
