Antibodies

View as table Download

CRP mouse monoclonal antibody, clone PC1, Purified

Applications ELISA, WB
Reactivities Porcine

CRP Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CRP, (C-Reactive Protein), mouse anti porcine, clone PC1 Biotin

Applications ELISA, IHC
Reactivities Porcine
Conjugation Biotin

C Reactive Protein (CRP) mouse monoclonal antibody, clone C7, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin

C Reactive Protein (CRP) mouse monoclonal antibody, clone C5, Aff - Purified

Applications ELISA
Reactivities Human

C Reactive Protein (CRP) mouse monoclonal antibody, clone C2, Aff - Purified

Applications ELISA
Reactivities Human

Rabbit Polyclonal Anti-CRP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRP antibody: synthetic peptide directed towards the N terminal of human CRP. Synthetic peptide located within the following region: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

C Reactive Protein (CRP) mouse monoclonal antibody, clone N1G1, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

C Reactive Protein (CRP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of Human CRP

C Reactive Protein (CRP) mouse monoclonal antibody, clone KT39, Aff - Purified

Applications ELISA
Reactivities Human

C Reactive Protein (CRP) mouse monoclonal antibody, clone KT39, Aff - Purified

Applications ELISA
Reactivities Human

C Reactive Protein (CRP) mouse monoclonal antibody, clone KT39, Aff - Purified

Applications ELISA
Reactivities Human

Rabbit anti CRP (IN) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human CRP protein (from 32aa-41aa). This sequence is identical to human and mouse.

Rabbit anti CRP (NT) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human CRP protein (from 42aa-49aa).

Rabbit anti CRP (NT) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human CRP protein (from 67aa-75aa). This sequence is identical to human, mouse and rat.

Anti-CRP Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related

Anti-CRP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related

C-Reactive Protein (CRP) Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Modifications Unmodified

CRP mouse monoclonal antibody,clone OTI7C3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".