Germany
Japan
United Kingdom
China
CRP mouse monoclonal antibody, clone PC1, Purified
| Applications | ELISA, WB |
| Reactivities | Porcine |
Antibodies
View as table Download
C Reactive Protein (CRP) mouse monoclonal antibody, clone C7, Biotin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Biotin |
C Reactive Protein (CRP) mouse monoclonal antibody, clone C5, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
C Reactive Protein (CRP) mouse monoclonal antibody, clone C2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit Polyclonal Anti-CRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRP antibody: synthetic peptide directed towards the N terminal of human CRP. Synthetic peptide located within the following region: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA |
C Reactive Protein (CRP) mouse monoclonal antibody, clone N1G1, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C Reactive Protein (CRP) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of Human CRP |
USD 1,280.00
2 Weeks
C Reactive Protein (CRP) mouse monoclonal antibody, clone KT39, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
C Reactive Protein (CRP) mouse monoclonal antibody, clone KT39, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
C Reactive Protein (CRP) mouse monoclonal antibody, clone KT39, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit anti CRP (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human CRP protein (from 32aa-41aa). This sequence is identical to human and mouse. |
Rabbit anti CRP (NT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human CRP protein (from 42aa-49aa). |
Rabbit anti CRP (NT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human CRP protein (from 67aa-75aa). This sequence is identical to human, mouse and rat. |
Anti-CRP Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related |
C-Reactive Protein (CRP) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human C-Reactive Protein (C-Reactive Protein (CRP)) |
| Modifications | Unmodified |
USD 447.00
2 Weeks
CRP mouse monoclonal antibody, clone OTI8G10
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 447.00
2 Weeks
CRP biotinylated mouse monoclonal antibody, clone OTI6H6
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI1H1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CRP mouse monoclonal antibody,clone OTI4G8
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CRP mouse monoclonal antibody,clone OTI4B4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CRP mouse monoclonal antibody,clone OTI7C10
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CRP mouse monoclonal antibody,clone OTI7C3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CRP mouse monoclonal antibody,clone OTI6F3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- CRP