Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CTBP1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Bacterially expressed recombinant human CtBP1. |
Rabbit polyclonal CtBP1 (Ab-422) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CtBP1 around the phosphorylation site of serine 422 (A-P-SP-P-G). |
Rabbit polyclonal CtBP1 (Ser422) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CtBP1 around the phosphorylation site of serine 422 (A-P-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit anti-CTBP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTBP1 |
Rabbit Polyclonal Anti-CtBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CtBP1 Antibody: A synthesized peptide derived from human CtBP1 |
Rabbit Polyclonal Anti-Phospho-CtBP1(Ser422) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-CtBP1(Ser422) Antibody: A synthesized peptide derived from human CtBP1 around the phosphorylation site of Sersine 422 |
| Modifications | Phospho-specific |
Rabbit polyclonal CTBP1 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This CTBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 413-440 amino acids from the C-terminal region of human CTBP1. |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
CTBP1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 412-442 amino acids from the C-terminal region of human CTBP1 |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the N terminal of human CTBP1. Synthetic peptide located within the following region: TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CTBP1 |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CTBP1 |
CtBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human CtBP1 (NP_001319.1). |
| Modifications | Unmodified |
CtBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human CtBP1 (NP_001319.1). |
CtBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human CtBP1 (NP_001319.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CTBP1