Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal HIF Prolyl Hydroxylase 3 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues between 50-100 of human Prolyl Hydroxylase Domain-Containing Protein 3 using the numbering given in entry NP_071356.1 (GeneID 112399). |
Goat Polyclonal Antibody against EGLN3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RLGKYYVKERSK, from the internal region of the protein sequence according to NP_071356.1. |
Rabbit Polyclonal Anti-EGLN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT |
Mouse monoclonal Anti-PHD3 Clone EG188e/d5
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-EGLN3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
PHD3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PHD3 (NP_071356.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EGLN3