Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-FKBP4 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP4 antibody: synthetic peptide directed towards the C terminal of human FKBP4. Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA |
Goat Anti-FKBP4 / FKBP52 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DHPTDTEMKEEQKSN, from the CTerminus of the protein sequence according to NP_002005.1. |
Mouse monoclonal FKBP52 Antibody
| Applications | IHC |
| Reactivities | Canine, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
FKBP4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4 |
FKBP4 Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse FKBP4 |
FKBP4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FKBP4 |
Active filters
Target Symbol
- FKBP4