Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FOXA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA |
Rabbit Polyclonal Anti-FOXA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2. Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS |
Anti-FOXA2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2 |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal Anti-FOXA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the middle region of human FOXA2. Synthetic peptide located within the following region: ASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALS |
Rabbit Polyclonal Anti-Foxa2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxa2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG |
Rabbit Polyclonal Anti-Foxa2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxa2 antibody: synthetic peptide directed towards the middle region of mouse Foxa2. Synthetic peptide located within the following region: SSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGL |
Rabbit anti FOXA-2 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human FOXA2 protein. This sequence is identical to rat, mouse and human origins. |
HNF3β/FOXA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HNF3β/HNF3β/FOXA2 |
| Modifications | Unmodified |
USD 420.00
5 Days
Active filters
Target Symbol
- FOXA2