Antibodies

View as table Download

Rabbit Polyclonal Anti-HAMP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM

HEPC (HAMP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 24~54 amino acids from the Central region of Human Hepcidin / HAMP

Rabbit polyclonal anti Hepcidin-25 (ms); purified rabbit IgG

Applications ELISA
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Thr-Asn-Phe-Pro-Ile-Cys-Leu-Phe-Cys-Cys- Lys-Cys-Cys-Lys-Asn-Ser-Ser-Cys-Gly-Leu-Cys-Cys-Ile-Thr-OH coupled to carrier protein.

HAMP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HAMP