Rabbit Polyclonal RAIDD Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RAIDD antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human RAIDD. The immunogen is located within the last 50 amino acids of RAIDD. |
Rabbit polyclonal Hrk BH3 Domain Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Hrk BH3 Domain antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-50 amino acids from human Hrk BH3 Domain. |
HRK rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 50 of human HRK. |
HRK rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | 15 amino acid peptide from near the centre of human HRK (NP_003797). |
HRK rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | 15 amino acid peptide from near the centre of human HRK (NP_003797). |
Rabbit Polyclonal Hrk Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | HRK antibody was raised against a 15 amino acid peptide from near the center of human Hrk. |
Rabbit Polyclonal Anti-HRK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HRK antibody: synthetic peptide directed towards the N terminal of human HRK. Synthetic peptide located within the following region: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW |
Germany
Japan
United Kingdom
China
