Goat Anti-IDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Goat Anti-IDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Rabbit Polyclonal Anti-IDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IDS antibody: synthetic peptide directed towards the N terminal of human IDS. Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDS mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
IDS Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse IDS |
IDS rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IDS |
IDS rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IDS |
IDS Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 34-290 of human IDS (NP_006114.1). |
Modifications | Unmodified |
USD 379.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
USD 159.00
2 Days
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 379.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
USD 159.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 379.00
In Stock
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
USD 159.00
2 Days
IDS (Iduronate 2 sulfatase) mouse monoclonal antibody, clone OTI4G2 (formerly 4G2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |