Germany
Japan
United Kingdom
China
USD 380.00
2 Weeks
Antibodies
View as table Download
Rabbit polyclonal IL-13R/CD213a1 (Tyr405) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-13R/CD213a1 around the phosphorylation site of tyrosine 405 (D-I-YP-E-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IL13RA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1. Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP |
Anti-IL13RA1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-363 amino acids of Human Interleukin 13 receptor, alpha 1 |
IL13RA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human I13R1 |
IL13RA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-343 of human IL13RA1 (NP_001551.1). |
| Modifications | Unmodified |
IL-13Rα1 (phospho-Y405) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human IL-13Rα1 around the phosphorylation site of Tyrosine 405. |
Active filters
Target Symbol
- IL13RA1