Antibodies

View as table Download

Rabbit Polyclonal ING1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Goat polyclonal anti-p33 ING1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole Goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 285-296 of Human p33 ING1 protein (Inhibitor of growth family, member 1). This sequence shows 100% homology to all splice variants for ING1.

Rabbit Polyclonal Anti-p33 ING1 Antibody

Applications WB
Reactivities Human and Mouse
Conjugation Unconjugated
Immunogen Mouse p33 ING1 N-terminal peptide –KLH conjugates

Rabbit Polyclonal Anti-ING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ING1 antibody: synthetic peptide directed towards the N terminal of human ING1. Synthetic peptide located within the following region: SPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGS

Rabbit Polyclonal Anti-ING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ING1 antibody: synthetic peptide directed towards the C terminal of human ING1. Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

Rabbit Polyclonal Anti-ING1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ING1

ING1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ING1

ING1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ING1

ING1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ING1
Modifications Unmodified