Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-KAT7 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KAT7 |
Rabbit Polyclonal Antibody against MYST2 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HBO1/MYST2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-130 amino acids from the N-terminal region of human HBO1/MYST2. |
Rabbit Polyclonal Anti-MYST2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: PRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQ |
Rabbit Polyclonal Antibody against MYST2 (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HBO1/MYST2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-246 amino acids from the Central region of human HBO1/MYST2. |
KAT7 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KAT7 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide mapping to the N-terminus of human HAT-2 |
Rabbit Polyclonal anti-MYST2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS |
Rabbit Polyclonal Anti-MYST2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS |
KAT7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human KAT7 |
KAT7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KAT7 |
Active filters
Target Symbol
- KAT7