Antibodies

Jump to Filters
View as table Download
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA332173

USD 310.00

In Stock

Rabbit Polyclonal Anti-JMJD1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JMJD1A Antibody: synthetic peptide directed towards the C terminal of human JMJD1A. Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA332511

USD 275.00

3 Weeks

Rabbit anti-KDM3A Polyclonal Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KDM3A
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA306828

USD 430.00

5 Days

Rabbit Polyclonal JMJD1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JMJD1A antibody was raised against a 16 amino acid peptide from near the amino terminus of human JMJD1A.
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA336794

USD 424.00

5 Days

Rabbit Polyclonal Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human JMJD1A protein (within residues 250-400). [Swiss-Prot Q9Y4C1]
KDM3A / JHDM2A (KDM3A) Mouse Monoclonal Antibody [Clone ID: 1E12]
TA336804

USD 424.00

5 Days

Mouse Monoclonal Lysine (K)-specific Demethylase 3A/KDM3A/JMJD1A Antibody (1E12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336804 is a replacement of AM06547SU-N.
KDM3A / JHDM2A (KDM3A) (C-term) Rabbit Polyclonal Antibody
AP52265PU-N

USD 450.00

2 Weeks

KDM3A / JHDM2A (KDM3A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 983-1017 amino acids from the C-terminal region of human JHDM2a.
KDM3A / JHDM2A (KDM3A) Mouse Monoclonal Antibody [Clone ID: OTI5A7]
CF812138

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KDM3A mouse monoclonal antibody,clone OTI5A7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA377753

USD 220.00

3 Weeks

KDM3A Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human KDM3A (NP_060903.2).
Modifications Unmodified