Antibodies

View as table Download

Rabbit Polyclonal JMJD2b Antibody

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JMJD2b antibody: human JMJD2b (Jumonji Domain containing 2b), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein.

KDM4B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 4-31 amino acids from the N-terminal region of human JMJD2B

Rabbit Polyclonal Anti-JMJD2B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JMJD2B antibody: synthetic peptide directed towards the middle region of human JMJD2B. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Rabbit Polyclonal Anti-JMJD2B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JMJD2B antibody: synthetic peptide directed towards the middle region of human JMJD2B. Synthetic peptide located within the following region: SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV

Rabbit polyclonal anti-JHD3B (KDM4B / JMJD2B) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human JHD3B.

Rabbit Polyclonal JMJD2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Immunogen JMJD2B antibody was raised against a 16 amino acid peptide from near the center of human JMJD2B.

KDM4B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 435-468 amino acids from the N-terminal region of human JMJD2B

KDM4B rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 287~316 amino acids from the C-terminal region of human JMJD2B

Rabbit Polyclonal Anti-KDM4B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KDM4B

KDM4B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KDM4B

KDM4B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KDM4B

KDM4B/JMJD2B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human KDM4B/JMJD2B (NP_055830.1).
Modifications Unmodified

KDM4B Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated