Antibodies

Jump to Filters
View as table Download
L3MBTL1 Rabbit Polyclonal Antibody
TA308637

USD 415.00

In Stock

Rabbit polyclonal antibody to L3MBTL (l(3)mbt-like (Drosophila))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 365 and 723 of L3MBTL
L3MBTL1 Rabbit Polyclonal Antibody
TA331951

USD 375.00

5 Days

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-L3MBTL Antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: RRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPE
L3MBTL1 Rabbit Polyclonal Antibody
TA339478

USD 375.00

5 Days

Rabbit Polyclonal Anti-L3MBTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-L3MBTL antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS
L3mbtl1 Rabbit Polyclonal Antibody
TA355894

USD 360.00

5 Days

L3mbtl Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl
L3mbtl1 Rabbit Polyclonal Antibody
TA355895

USD 360.00

5 Days

L3mbtl Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl
L3MBTL1 Rabbit Polyclonal Antibody
TA359902

USD 360.00

5 Days

L3MBTL1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human LMBL1
L3MBTL1 Rabbit Polyclonal Antibody
TA359904

USD 360.00

5 Days

L3MBTL1 Antibody - N-terminal

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-L3MBTL1 antibody is: synthetic peptide directed towards the N-terminal of Human LMBL1
L3MBTL1 Human Monoclonal Antibody [Clone ID: RAB-C213]
TA386462

USD 675.00

2 Weeks

Recombinant Anti-L3MBTL1 (Clone RAB-C213)

Applications ChIP, ELISA, FC, IF
Reactivities Human
Conjugation His Tag
L3MBTL1 Rabbit Monoclonal Antibody [Clone ID: RAB-C213]
TA386463

USD 523.00

2 Weeks

Recombinant Anti-L3MBTL1 (Clone RAB-C213)

Applications ChIP, ELISA, FC, IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.